PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678345865
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family SRS
Protein Properties Length: 352aa    MW: 37813.5 Da    PI: 6.8368
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678345865genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702208.91.3e-641142773155
     DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa..........aeaaskrkrel...kskkqsalsst 89 
                 g++sCqdCGnqakkdC+h+RCRtCCksrgf+C+thvkstWvpaa rrerqq+ a++++++++++           +++ kr+r +    ++++++l +t
  678345865 114 GGGISCQDCGNQAKKDCSHMRCRTCCKSRGFQCSTHVKSTWVPAAVRRERQQRIATLQQQNQNQEqrrereippgVKENGKRQRAEdtsPEHNNNSLVCT 213
                5789*************************************************99998887776668888888885555555555432223344555556 PP

     DUF702  90 klssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGleek 155
                +++++   + le  ++P+evsseavfrcvrv++ ddge++l+Yqtav+i GhvfkGiLy+qG++++
  678345865 214 RIVTS--MTGLELGTFPSEVSSEAVFRCVRVTTSDDGEDKLGYQTAVNICGHVFKGILYNQGVDNQ 277
                65554..55678888************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051426.2E-62116275IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016239.4E-27118160IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016243.0E-25227274IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010252Biological Processauxin homeostasis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048479Biological Processstyle development
GO:0048480Biological Processstigma development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MAGFFSLCTG GGGAATADHE TSGHNNNTNN NGEMNPESWF LYRNEENPYK SFELWQPQPQ  60
PQPQAENFLQ RGTTLQDLYA SAGGLAVGPG SGGFSISGDH SPRSGFLMMR SSGGGGISCQ  120
DCGNQAKKDC SHMRCRTCCK SRGFQCSTHV KSTWVPAAVR RERQQRIATL QQQNQNQEQR  180
REREIPPGVK ENGKRQRAED TSPEHNNNSL VCTRIVTSMT GLELGTFPSE VSSEAVFRCV  240
RVTTSDDGED KLGYQTAVNI CGHVFKGILY NQGVDNQQYM AGDTSSGGGG SVTASGAQQQ  300
QLNLITGGAG TATSDPNTST TPGTSPFLDP SLYPPPINSF MAGNQFFPAS RS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00613PBMTransfer from AT3G51060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011100954.11e-132PREDICTED: protein SHORT INTERNODES
TrEMBLS8C9901e-139S8C990_9LAMI; Uncharacterized protein
STRINGSolyc02g084680.2.17e-96(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA67824110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.18e-65Lateral root primordium (LRP) protein-related